APYRASE

Sep 9, 11
Other articles:
  • by M DEY - Cited by 2 - Related articles
  • ap·y·rase ( p -r s , -r z ). n. Any of various enzymes that catalyze the hydrolysis of ATP, causing the release of phosphate and energy. .
  • by J van der Pals - 2010 - Cited by 1 - Related articles
  • Your browser may not have a PDF reader available. Google recommends visiting our text version of this document.
  • This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (EC:3.6.1.5), and related nucleoside diphosphatases (EC:3.6.1.6). .
  • Find the right expert or researcher from Johns Hopkins University (JHU) on Apyrase. Apyrase: A calcium-activated enzyme that catalyzes the hydrolysis of ATP .
  • Title, A calcium-activated apyrase from Teladorsagia circumcincta: an excretory/ secretory antigen capable of modulating host immune responses? .
  • Abstract: DESCRIPTION (provided by applicant): Human apyrase represents a highly promising therapy for acute ischemic stroke which is a leading cause of .
  • A genetic screen in yeast revealed that the Golgi apyrase Ynd1 associates with E4orf4 and contributes to E4orf4-induced toxicity, independently of Ynd1 .
  • Apyrase. . Previously selected filters. Biomolecule Products : Apyrase (ATP diphosphohydrolase) (clear filter); Type : Enzymes (clear filter) .
  • by D Riewe - 2008 - Cited by 22 - Related articles
  • apyrase liked a video (8 months ago). the Pogues - a Pair of Brow. here's a great video from the pogues. enjoy! Subscriptions (1) .
  • by CT Smartt - 1995 - Cited by 34 - Related articles
  • Apyrase. . Krishman, P.S. Apyrase, pyrophosphatase and metaphosphatase of Penicillium chrysogenum. Arch. Biochem. Biophys. 37 (1952) 224-234. 2. .
  • File Format: PDF/Adobe Acrobat - Quick View
  • by C Thomas - 1999 - Cited by 77 - Related articles
  • Definition of APYRASE. : any of several enzymes that catalyze the hydrolysis of ATP to AMP with the liberation of phosphate and energy .
  • Jul 27, 2011 – >tr|Q70KY5|Q70KY5_KLULC Apyrase OS=Kluyveromyces lactis GN=ynd1 PE=4 SV=1 MIITGSDEQYKQYGIVIDAGSSGSRIHIYQWDSPQHVLNSKGQEEADKDGSQIALLQSVP .
  • by D Santapaola - 2006 - Cited by 12 - Related articles
  • `Apyrase` is a calcium-activated plasma membrane-bound enzyme (magnesium can also activate it) that catalyses the hydrolysis of ATP to yield AMP and .
  • Abstract: DESCRIPTION (provided by applicant): Human apyrase represents a highly promising therapy for acute ischemic stroke which is a leading cause of .
  • additional information, Ornithodoros savignyi, the apyrase belongs to the 5'- nucleotidase family; the apyrase belongs to the 5'-nucleotidase family, 697819 .
  • File Format: PDF/Adobe Acrobat - Quick View
  • Apyrase (adenosine diphosphatase) is a calcium-activated plasma membrane- bound enzyme (magnesium can also activate it) (EC 3.6.1.5) that catalyses the .
  • Steam Profile. Apyrase. Also known as. Apyrase. Profile _. John Y. Texas, United States. No information given. why hello there. Comments _ .
  • Title: A calcium-activated apyrase from Teladorsagia circumcincta: an excretory/ secretory antigen capable of modulating host immune responses? Authors .
  • Your browser may not have a PDF reader available. Google recommends visiting our text version of this document.
  • Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma .
  • by B Windsor - 2003 - Cited by 53 - Related articles
  • by K Maruyama - 1956 - Cited by 1 - Related articles
  • English-English translation for apyrase - online dictionary EUdict.com.
  • 199188, Wang T.-F.,Rosenberg P.A.,Guidotti G. Characterization of brain ecto- apyrase: evidence for only one ecto-apyrase (CD39) gene. Brain Res. Mol. .
  • Apyrase - Description: Apyrase (adenosine diphosphatase) is a calcium- activated plasma membrane-bound enzyme (magnesium can also activate it) that .
  • Accepted Name. Apyrase. Alternative Name(s). Adenosine diphosphatase. ADPase. ATP-diphosphatase. ATP-diphosphohydrolase. Reaction catalysed .
  • To promote the growth and development of plant biology, to encourage and publish research in plant biology, and to promote the interests and growth of plant .
  • Is Apyrase a Scrabble word? Is it Scrabble dictionary, and What is Apyrase definition, Anagrams of Apyrase, Scrabble score for Apyrase, images of Apyrase, and .
  • Lysosomal apyrase like protein 1; Apyrase, lysosomal; Ectonucleoside triphosphate diphosphohydrolase 4; ENTPD4; KIAA0392; LALP70; LAP70; Lysosomal apyrase .
  • IPR006179 5_nucleotidase/apyrase . acts as a 3'-nucleotidase; and mosquito .
  • Apyrase and A-NSAPs share three domains of conserved amino acids (domains D1–D3) containing residues forming the putative active site of apyrase. .
  • The salivary gland-specific apyrase of the mosquito Aedes aegypti is a member of the 5'-nucleotidase family. Proc. Natl. Acad. Sci. .
  • (1999) reported the isolation of an apyrase (i.e., nucleotide phosphohydrolase) from the legume Dolichos biflorus that had the ability to bind to rhizobial Nod .
  • File Format: PDF/Adobe Acrobat - Quick View
  • Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma phosphate from ATP and the beta phosphate from ADP. The phosphate from .
  • Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma phosphate from ATP and the beta phosphate from ADP. The phosphate from AMP is .
  • Know everything about the word APYRASE in TWL06: definition, anagram, hook, extensions, .
  • Buy and find information on Sigma-Apyrase from potato, Product Number A6535, CAS Number 9000-95-7, MSDS.
  • Mar 1, 2011 – Apyrase, ATP diphosphohydrolase, not only hydrolyzes ATP, but also other nucleoside tri- and diphosphates. Hydrolysis of ATP and GTP .
  • The SCOP classification for the Apyrase superfamily including the families contained in it. Additional information provided includes InterPro annotation (if .
  • To apply these findings to an agriculturally relevant plant we transformed apyrase into tomatoes (Solanum lycopersicum, MicroTom). Our goal is to overexpress .

  • Sitemap