Other articles:
|
by M DEY - Cited by 2 - Related articles
ap·y·rase ( p -r s , -r z ). n. Any of various enzymes that catalyze the hydrolysis of ATP, causing the release of phosphate and energy. .
by J van der Pals - 2010 - Cited by 1 - Related articles
Your browser may not have a PDF reader available. Google recommends visiting our text version of this document.
This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (EC:3.6.1.5), and related nucleoside diphosphatases (EC:3.6.1.6). .
Find the right expert or researcher from Johns Hopkins University (JHU) on Apyrase. Apyrase: A calcium-activated enzyme that catalyzes the hydrolysis of ATP .
Title, A calcium-activated apyrase from Teladorsagia circumcincta: an excretory/ secretory antigen capable of modulating host immune responses? .
Abstract: DESCRIPTION (provided by applicant): Human apyrase represents a highly promising therapy for acute ischemic stroke which is a leading cause of .
A genetic screen in yeast revealed that the Golgi apyrase Ynd1 associates with E4orf4 and contributes to E4orf4-induced toxicity, independently of Ynd1 .
Apyrase. . Previously selected filters. Biomolecule Products : Apyrase (ATP diphosphohydrolase) (clear filter); Type : Enzymes (clear filter) .
by D Riewe - 2008 - Cited by 22 - Related articles
apyrase liked a video (8 months ago). the Pogues - a Pair of Brow. here's a great video from the pogues. enjoy! Subscriptions (1) .
by CT Smartt - 1995 - Cited by 34 - Related articles
Apyrase. . Krishman, P.S. Apyrase, pyrophosphatase and metaphosphatase of Penicillium chrysogenum. Arch. Biochem. Biophys. 37 (1952) 224-234. 2. .
File Format: PDF/Adobe Acrobat - Quick View
by C Thomas - 1999 - Cited by 77 - Related articles
Definition of APYRASE. : any of several enzymes that catalyze the hydrolysis of ATP to AMP with the liberation of phosphate and energy .
Jul 27, 2011 – >tr|Q70KY5|Q70KY5_KLULC Apyrase OS=Kluyveromyces lactis GN=ynd1 PE=4 SV=1 MIITGSDEQYKQYGIVIDAGSSGSRIHIYQWDSPQHVLNSKGQEEADKDGSQIALLQSVP .
by D Santapaola - 2006 - Cited by 12 - Related articles
`Apyrase` is a calcium-activated plasma membrane-bound enzyme (magnesium can also activate it) that catalyses the hydrolysis of ATP to yield AMP and .
Abstract: DESCRIPTION (provided by applicant): Human apyrase represents a highly promising therapy for acute ischemic stroke which is a leading cause of .
additional information, Ornithodoros savignyi, the apyrase belongs to the 5'- nucleotidase family; the apyrase belongs to the 5'-nucleotidase family, 697819 .
File Format: PDF/Adobe Acrobat - Quick View
Apyrase (adenosine diphosphatase) is a calcium-activated plasma membrane- bound enzyme (magnesium can also activate it) (EC 3.6.1.5) that catalyses the .
Steam Profile. Apyrase. Also known as. Apyrase. Profile _. John Y. Texas, United States. No information given. why hello there. Comments _ .
Title: A calcium-activated apyrase from Teladorsagia circumcincta: an excretory/ secretory antigen capable of modulating host immune responses? Authors .
Your browser may not have a PDF reader available. Google recommends visiting our text version of this document.
Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma .
by B Windsor - 2003 - Cited by 53 - Related articles
by K Maruyama - 1956 - Cited by 1 - Related articles
English-English translation for apyrase - online dictionary EUdict.com.
199188, Wang T.-F.,Rosenberg P.A.,Guidotti G. Characterization of brain ecto- apyrase: evidence for only one ecto-apyrase (CD39) gene. Brain Res. Mol. .
Apyrase - Description: Apyrase (adenosine diphosphatase) is a calcium- activated plasma membrane-bound enzyme (magnesium can also activate it) that .
Accepted Name. Apyrase. Alternative Name(s). Adenosine diphosphatase. ADPase. ATP-diphosphatase. ATP-diphosphohydrolase. Reaction catalysed .
To promote the growth and development of plant biology, to encourage and publish research in plant biology, and to promote the interests and growth of plant .
Is Apyrase a Scrabble word? Is it Scrabble dictionary, and What is Apyrase definition, Anagrams of Apyrase, Scrabble score for Apyrase, images of Apyrase, and .
Lysosomal apyrase like protein 1; Apyrase, lysosomal; Ectonucleoside triphosphate diphosphohydrolase 4; ENTPD4; KIAA0392; LALP70; LAP70; Lysosomal apyrase .
IPR006179 5_nucleotidase/apyrase . acts as a 3'-nucleotidase; and mosquito .
Apyrase and A-NSAPs share three domains of conserved amino acids (domains D1–D3) containing residues forming the putative active site of apyrase. .
The salivary gland-specific apyrase of the mosquito Aedes aegypti is a member of the 5'-nucleotidase family. Proc. Natl. Acad. Sci. .
(1999) reported the isolation of an apyrase (i.e., nucleotide phosphohydrolase) from the legume Dolichos biflorus that had the ability to bind to rhizobial Nod .
File Format: PDF/Adobe Acrobat - Quick View
Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma phosphate from ATP and the beta phosphate from ADP. The phosphate from .
Apyrase is an ATP diphosphohydrolase. It catalyses the removal of the gamma phosphate from ATP and the beta phosphate from ADP. The phosphate from AMP is .
Know everything about the word APYRASE in TWL06: definition, anagram, hook, extensions, .
Buy and find information on Sigma-Apyrase from potato, Product Number A6535, CAS Number 9000-95-7, MSDS.
Mar 1, 2011 – Apyrase, ATP diphosphohydrolase, not only hydrolyzes ATP, but also other nucleoside tri- and diphosphates. Hydrolysis of ATP and GTP .
The SCOP classification for the Apyrase superfamily including the families contained in it. Additional information provided includes InterPro annotation (if .
To apply these findings to an agriculturally relevant plant we transformed apyrase into tomatoes (Solanum lycopersicum, MicroTom). Our goal is to overexpress .
Sitemap
|